Basic Information | |
---|---|
Taxon OID | 3300000891 Open in IMG/M |
Scaffold ID | JGI10214J12806_10592430 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 734 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Iowa, USA | |||||||
Coordinates | Lat. (o) | 43.303333 | Long. (o) | -89.334167 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F037793 | Metagenome | 167 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI10214J12806_105924302 | F037793 | N/A | LAHWREQYRLAVEDLENLQSSRKKVAEDTGEGWVDATDHWADRVRNEVAVFAQLIEVYEKLNARNGSS* |
⦗Top⦘ |