NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12032J12867_1008190

Scaffold JGI12032J12867_1008190


Overview

Basic Information
Taxon OID3300000912 Open in IMG/M
Scaffold IDJGI12032J12867_1008190 Open in IMG/M
Source Dataset NameForest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)631
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameEl Dorado National Forest, Georgetown, California, USA
CoordinatesLat. (o)38.88Long. (o)-120.64Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001278Metagenome / Metatranscriptome733Y

Sequences

Protein IDFamilyRBSSequence
JGI12032J12867_10081901F001278N/ANEKIHSIRPVPSSANGWMYFPHQRGDVLDFSLTSFPCAKPHVEDRVSTRAFQKSSALAEAEIVPYLRRAELARSLSELFGCRIRENKKGSGLYAMPSEAQRSICGCETQNLRFELCANELRASLVLPSGEVLRDLPVVDHDWRNFVDAALALNRGANRLPRLERFLNSHFHYKIMSCPHHFIRLGLTRPYHDLCWLMLDTLFPLPRQEW
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.