Scaffold NpDRAFT_10001395

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold NpDRAFT_10001395

Scaffold NpDRAFT_10001395

Overview

Basic Information
Taxon OID	3300000929 Open in IMG/M
Scaffold ID	NpDRAFT_10001395 Open in IMG/M
Source Dataset Name	Marine plume microbial communities from the Columbia River - 15 PSU
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9060
Total Scaffold Genes	27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	18 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location Name	Columbia River plume, coastal ocean
Coordinates	Lat. (^o)	46.239	Long. (^o)	-124.161	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073095	Metagenome / Metatranscriptome	120	N

Sequences

Protein ID	Family	RBS	Sequence
NpDRAFT_1000139521	F073095	N/A	IQVTQRKPKGEGPGASEFFNHLSLTKHQARQLATELLLFAEGREID

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.