NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold NpDRAFT_10074963

Scaffold NpDRAFT_10074963


Overview

Basic Information
Taxon OID3300000929 Open in IMG/M
Scaffold IDNpDRAFT_10074963 Open in IMG/M
Source Dataset NameMarine plume microbial communities from the Columbia River - 15 PSU
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1071
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location NameColumbia River plume, coastal ocean
CoordinatesLat. (o)46.239Long. (o)-124.161Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001562Metagenome / Metatranscriptome670Y
F004431Metagenome / Metatranscriptome438Y
F009143Metagenome / Metatranscriptome322Y

Sequences

Protein IDFamilyRBSSequence
NpDRAFT_100749631F004431N/ALTKRIENKMTITYSLWDGAQLLGAGFTAKSADEMNKVVADLQKVSKNVVAHMRKVEM*
NpDRAFT_100749632F009143AGGTGGMMTKWDTIQADVADAYVYLEEEEAYNKALAEGLDLRLSEYEEDEMSKSLTLDWEAYE*
NpDRAFT_100749635F001562GAGMKSQFEKDLEIKESFIDLLNDIYPTVKIGYSTFTPAEILECCDPVAFAIGLVEHEDYLAELEDET*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.