NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold NpDRAFT_10090931

Scaffold NpDRAFT_10090931


Overview

Basic Information
Taxon OID3300000929 Open in IMG/M
Scaffold IDNpDRAFT_10090931 Open in IMG/M
Source Dataset NameMarine plume microbial communities from the Columbia River - 15 PSU
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Maryland
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2800
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine → Freshwater And Marine Microbial Communities From The Columbia River, Usa, Of Estuaries And Plumes Across Salinity Gradients

Source Dataset Sampling Location
Location NameColumbia River plume, coastal ocean
CoordinatesLat. (o)46.239Long. (o)-124.161Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F087184Metagenome / Metatranscriptome110N
F091943Metagenome / Metatranscriptome107N
F093301Metagenome / Metatranscriptome106N

Sequences

Protein IDFamilyRBSSequence
NpDRAFT_100909312F093301GGAGVTTLVAIQGDGWSVIGCDSRSSDESGRYLEMATHKVVENNGILIAGSGAGRGSNILQFGWRAPRPKAGQDLDVFMTKVFIPSMRKVFIESGYDMKADGEAAAHDSEFIVSIHGVLYPIYEDYSWDREERNIYHSGSGSDLALGVLEALNYQKCK
NpDRAFT_100909313F087184AGGAMNIGELTSEIESGTFDSDLIKIKEAVDARLKASRTSRTLADFNIGDTVVFNDLTATRYMVGQKATITGMKQKKVTVRLETPVGRFAHINPVTGRVESSNITVPVAIIDLVK*
NpDRAFT_100909315F091943AGGAMTKKWCLLKSSDGQRGANGKRKIYEVTVDGSVVRTSWGMAEKPVRQSEVKNYRDDFYARQMAFMKVQEKLNKGYKLAYAV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.