NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold BBAY92_10192718

Scaffold BBAY92_10192718


Overview

Basic Information
Taxon OID3300000947 Open in IMG/M
Scaffold IDBBAY92_10192718 Open in IMG/M
Source Dataset NameMacroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)531
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Source Dataset Sampling Location
Location NameBotany Bay, Sydney, NSW, Australia
CoordinatesLat. (o)-33.966629Long. (o)151.166614Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012166Metagenome283Y

Sequences

Protein IDFamilyRBSSequence
BBAY92_101927182F012166GAGMADLANSGIFLEQKLTPEQKLWKAVLSQGVYEACSKRAQALPLTYGEMRSALEWVDLGNRDFIQVCIYAGYDPAYVYRKAKGKIKVYEKNM*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.