NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI11881J13070_1001326

Scaffold JGI11881J13070_1001326


Overview

Basic Information
Taxon OID3300000950 Open in IMG/M
Scaffold IDJGI11881J13070_1001326 Open in IMG/M
Source Dataset NameMarine microbial communities from the Deep Atlantic Ocean - MP0441
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2640
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (42.86%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NameEast of Rio de Janeiro, Brazil, South Atlantic Ocean
CoordinatesLat. (o)-22.97Long. (o)-36.95Alt. (m)Depth (m)3906.8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012125Metagenome283Y

Sequences

Protein IDFamilyRBSSequence
JGI11881J13070_10013264F012125N/AMSDTRYSVMHPDGGKDSFFSAGKPKNLPRFYFLVLAGIFLIIFMFMWFD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.