NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI11615J12901_10053646

Scaffold JGI11615J12901_10053646


Overview

Basic Information
Taxon OID3300000953 Open in IMG/M
Scaffold IDJGI11615J12901_10053646 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Kansas Corn soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)786
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameKansas, USA
CoordinatesLat. (o)39.211666Long. (o)-96.594768Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046621Metagenome151Y

Sequences

Protein IDFamilyRBSSequence
JGI11615J12901_100536461F046621N/AIDFESGANRPDGLGFLEIDGVYFFGLGGVPSIVTGQNGNKLLHESTVGEITRLTIFLPPGTTAVGVDQFNRPMIVSTSTGESVTMEQSDNSDFVGFVSDQPIQSLVIMFDFPEPTPDALVDNLSFGQRRVGNEPPVPQLLVTNTGRAAALDSVTTTSEPFLVLGSQLLATDGHTRITLFVVGVLLQPSDLPFVTVQAEDSQQRLFDLPCEATARVKNLSWMSQVTVRLPDALIGAGDVNIRVRVRGKESNPATLRIQ*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.