Scaffold BBAY93_10081846

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BBAY93_10081846

Scaffold BBAY93_10081846

Overview

Basic Information
Taxon OID	3300000973 Open in IMG/M
Scaffold ID	BBAY93_10081846 Open in IMG/M
Source Dataset Name	Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	826
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface → Macroalgal Surface Microbial Communities

Source Dataset Sampling Location
Location Name	Botany Bay, Sydney, NSW, Australia
Coordinates	Lat. (^o)	-33.966629	Long. (^o)	151.166614	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F093806	Metagenome	106	N

Sequences

Protein ID	Family	RBS	Sequence
BBAY93_100818461	F093806	N/A	MFEISWIQNDARIIQRQLPRALGFGEFVVSMAIKDLLYCIAYNEDSQLSNLDFFGPLHLEVRFDNGIESVIYSSLNQKTLFNPGSFAIGSDAHSFCSFYTAHLVLWESKRFYEREKLRDGGPLYELFYWRFMTDKGMHVNMLYDRVYSFRSYIGSFIEVKDNPTEYMDIEEEFKRSLTTKRFYAEQPQFFQVLVNPIDGMNAFSKKHNCCAICNTKIKQELEYGYCINCA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.