Scaffold JGI12126J13095_100428

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12126J13095_100428

Scaffold JGI12126J13095_100428

Overview

Basic Information
Taxon OID	3300000999 Open in IMG/M
Scaffold ID	JGI12126J13095_100428 Open in IMG/M
Source Dataset Name	Marine microbial communities from the Deep Pacific Ocean - MP1494
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2110
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (28.57%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosarchaeum	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	South of Fiji, South Pacific Ocean
Coordinates	Lat. (^o)	-25.49	Long. (^o)	-179.52	Alt. (m)		Depth (m)	2147.76
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076187	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12126J13095_1004281	F076187	N/A	THFFEFISIEKFFENFKTSRNVKSFPKIPLIPDTDIFNASNLDTLFINSERKWLVPR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.