NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12569J13230_100181

Scaffold JGI12569J13230_100181


Overview

Basic Information
Taxon OID3300001074 Open in IMG/M
Scaffold IDJGI12569J13230_100181 Open in IMG/M
Source Dataset NameForest soil microbial communities from Willamette National Forest, Oregon, USA, amended with Nitrogen - NN397
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1081
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil → Soil Microbial Communities From 10 Grassland Sites In Ca, Co, Ks, Ky, Mn, Mo, Nm, Sc, Tx, That Have Been Nitrogen Fertilized

Source Dataset Sampling Location
Location NameWillamette National Forest, Oregon, USA
CoordinatesLat. (o)44.20517707Long. (o)-122.1284473Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014962Metagenome / Metatranscriptome258Y

Sequences

Protein IDFamilyRBSSequence
JGI12569J13230_1001813F014962GGAGGMIDWTEELLMQIEAFSRVALTYPGIDGYPVVLPLPHVFDRDKRCFILPIPHQRPVPASEEQVSLTLLHYDEQMKFERYLLLYGHLTETGNEWIFTPSHVVLPRWGR*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.