NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12683J13190_1000520

Scaffold JGI12683J13190_1000520


Overview

Basic Information
Taxon OID3300001089 Open in IMG/M
Scaffold IDJGI12683J13190_1000520 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5463
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (57.14%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000232Metagenome / Metatranscriptome1513Y
F007330Metagenome / Metatranscriptome353Y
F010863Metagenome / Metatranscriptome298Y

Sequences

Protein IDFamilyRBSSequence
JGI12683J13190_10005202F000232N/AMKHPKQSKRAPPTHASALAVPSYHRILVKHGLIEKTLPIPDAYKVFLQVGADPEVQKLHRKVEHGNRMKHVPALYLATAMALQGMTKQQLEALKLRIEKKRV*
JGI12683J13190_10005203F010863GGAMIRGPSDLKDAAVRGTMSAAEDKMFSVVGLTLDEVSTGSLPHVHLAKTLDSRMTKSNFRYAEKILVYTTVETDTQGLVARTKYRQQGQFLVFLYFNDAAVEACKEIGIPLRILDRIDECELPSRRTTVLERPYLAPVSK*
JGI12683J13190_10005204F007330N/AMGILYRIKDTRIAMRISKSFTIEPDISSYVDETKGERSASDRVNELLRRAMLQEQYDRLEAEAAEFFADAEEHRAGTKAFEKASIRTFGRD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.