NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SHO09A_101441

Scaffold SHO09A_101441


Overview

Basic Information
Taxon OID3300001093 Open in IMG/M
Scaffold IDSHO09A_101441 Open in IMG/M
Source Dataset Name07SHO09A
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1457
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Spring → Thermal Spring Microbial Communities From Shoshone Spring, Yellowstone National Park

Source Dataset Sampling Location
Location NameShoshone Yellowstone National Park
CoordinatesLat. (o)44.3564059Long. (o)-110.7977012Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F100050Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
SHO09A_1014412F100050N/AMDAIIRYMVATLLAVVGGYIGYHFVPVVPFGVVGNVLFLGALFGLVVGLFGFTGFFGNLVNALILSMPLYFVLPGEWFVIWTGGNAGYALGNVFGQLAVLSVTKRIEARAL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.