Scaffold JGI11944J13513_1003370

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI11944J13513_1003370

Scaffold JGI11944J13513_1003370

Overview

Basic Information
Taxon OID	3300001096 Open in IMG/M
Scaffold ID	JGI11944J13513_1003370 Open in IMG/M
Source Dataset Name	Wastewater bioreactor microbial communities from Singapore -Terephthalate degrading community TA Sludge
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	10075
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → Syntrophus aciditrophicus	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Terephthalate → Wastewater → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Singapore And Univ Of Illinois At Urbana, That Are Terephthalate-Degrading

Source Dataset Sampling Location
Location Name	National University of Singapore, Singapore
Coordinates	Lat. (^o)	1.29973	Long. (^o)	103.771791	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067893	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI11944J13513_10033709	F067893	GAG	MQTVYPRYTMAERLVLAVVAVVTWPAARFLGWVRRKAAAGPAP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.