Basic Information | |
---|---|
Taxon OID | 3300001096 Open in IMG/M |
Scaffold ID | JGI11944J13513_1047670 Open in IMG/M |
Source Dataset Name | Wastewater bioreactor microbial communities from Singapore -Terephthalate degrading community TA Sludge |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 879 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Bioremediation → Terephthalate → Wastewater → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Singapore And Univ Of Illinois At Urbana, That Are Terephthalate-Degrading |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | National University of Singapore, Singapore | |||||||
Coordinates | Lat. (o) | 1.29973 | Long. (o) | 103.771791 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001057 | Metagenome / Metatranscriptome | 791 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI11944J13513_10476702 | F001057 | N/A | MKTTVELDASNRIVLSRELRRAAGIPRKQKLLVSATPGRIVLEMPANTSGRLIPRGKLKVWTGAVPATPVEEAVEQSRHYTR* |
⦗Top⦘ |