NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI11944J13513_1064712

Scaffold JGI11944J13513_1064712


Overview

Basic Information
Taxon OID3300001096 Open in IMG/M
Scaffold IDJGI11944J13513_1064712 Open in IMG/M
Source Dataset NameWastewater bioreactor microbial communities from Singapore -Terephthalate degrading community TA Sludge
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)666
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Candidatus Methanofastidiosa → unclassified Candidatus Methanofastidiosa → Candidatus Methanofastidiosa archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Terephthalate → Wastewater → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Singapore And Univ Of Illinois At Urbana, That Are Terephthalate-Degrading

Source Dataset Sampling Location
Location NameNational University of Singapore, Singapore
CoordinatesLat. (o)1.29973Long. (o)103.771791Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070633Metagenome / Metatranscriptome123N

Sequences

Protein IDFamilyRBSSequence
JGI11944J13513_10647121F070633N/AFVYSVRQHLPIGPKKCTGGFNLVVVPLSDGILTSIDRDNFNVAVDTEGRLILTRLDRKIQLVFDYDKGFMTGVLGGVLYDTFEIPKHEGTDYHG*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.