NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SMH020_1005518

Scaffold SMH020_1005518


Overview

Basic Information
Taxon OID3300001109 Open in IMG/M
Scaffold IDSMH020_1005518 Open in IMG/M
Source Dataset Name04YSMH020
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1592
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Spring → Thermal Spring Microbial Communities From Shoshone Spring, Yellowstone National Park

Source Dataset Sampling Location
Location NameSeven Mile Hole Yellowstone National Park
CoordinatesLat. (o)44.75491405Long. (o)-110.41586031Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F027904Metagenome / Metatranscriptome193N

Sequences

Protein IDFamilyRBSSequence
SMH020_10055182F027904GGTGGMKKYEPPEYDLFNLNNGSTLVGTTPASLLYEGQPTAAVIAPPDLTMRVKQVIIQNATASLITVQLQAVTTITGAPTPVAKTPPIPVPASSAVTLDEEEWSISVKPGYSLAAVSSAANSANVFVKAYFVKGTGSPI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.