NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI12636J13339_1003027

Scaffold JGI12636J13339_1003027


Overview

Basic Information
Taxon OID3300001154 Open in IMG/M
Scaffold IDJGI12636J13339_1003027 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2805
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009172Metagenome / Metatranscriptome322Y
F021504Metagenome / Metatranscriptome218Y

Sequences

Protein IDFamilyRBSSequence
JGI12636J13339_10030272F009172GAGMAEDNKKSTEKPAAPGTRKPYTKPNATSEPIYETLALACGKLPGQGGLCNAAPRRS*
JGI12636J13339_10030273F021504GGAGGMGRIRLAVLIFASLGLLLCVSQEAAAQSSNRLGKRNEERGDSTSDARLRPRRPQPRPRGPEIFYCETPDTSCRTTQDTFAIADLRDLFVFVVWPGVSGQHVQTVEFLLPGGSIYSSKKTRFSIGGASRVAAMAPAFKNEVSPVPPAPHLIAEANKVHPEGIPTLLMKSRGDSSVLTVLPVGGTYITQRNLSGTWRVRVLLDDRFALESEFTLVPREPPPAAKAEEKAER*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.