Basic Information | |
---|---|
Taxon OID | 3300001228 Open in IMG/M |
Scaffold ID | SwM_105728 Open in IMG/M |
Source Dataset Name | Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Tennessee |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 534 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | East Tennessee Research and Education Center, Knoxville, Tennessee, USA | |||||||
Coordinates | Lat. (o) | 35.9606 | Long. (o) | -83.9208 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F053475 | Metagenome / Metatranscriptome | 141 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
SwM_1057282 | F053475 | N/A | LGIGSDSGITLLTGFFIGTALTWFSTIELLCHLGEKQGRQIMLRVMQSLCVLCIAAGVVQLARAANLLGI* |
⦗Top⦘ |