Scaffold SwM_110045

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold SwM_110045

Scaffold SwM_110045

Overview

Basic Information
Taxon OID	3300001228 Open in IMG/M
Scaffold ID	SwM_110045 Open in IMG/M
Source Dataset Name	Switchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Tennessee
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	518
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa

Source Dataset Sampling Location
Location Name	East Tennessee Research and Education Center, Knoxville, Tennessee, USA
Coordinates	Lat. (^o)	35.9606	Long. (^o)	-83.9208	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F091754	Metagenome	107	Y

Sequences

Protein ID	Family	RBS	Sequence
SwM_1100452	F091754	GAG	MRIGLAYNQKPDTDPTPDRASKTADVYAEWDEPSTIDAVEQALG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.