NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold SwM_135023

Scaffold SwM_135023


Overview

Basic Information
Taxon OID3300001228 Open in IMG/M
Scaffold IDSwM_135023 Open in IMG/M
Source Dataset NameSwitchgrass rhizosphere microbial communities from Knoxville, Tennessee, USA - 12_joined
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Tennessee
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)522
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere → Switchgrass Rhizosphere Microbial Communities From Knoxville, Tennessee, Usa

Source Dataset Sampling Location
Location NameEast Tennessee Research and Education Center, Knoxville, Tennessee, USA
CoordinatesLat. (o)35.9606Long. (o)-83.9208Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038297Metagenome / Metatranscriptome166Y

Sequences

Protein IDFamilyRBSSequence
SwM_1350231F038297GGGGGMGQAAKPTRHNRTITVDFHDETTYLALLDTPHAFVEFVLAFLLALSAFSSSTKPAAV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.