NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J13895_1001585

Scaffold B570J13895_1001585


Overview

Basic Information
Taxon OID3300001274 Open in IMG/M
Scaffold IDB570J13895_1001585 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3158
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, WI
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001106Metagenome / Metatranscriptome776Y
F054867Metagenome / Metatranscriptome139Y

Sequences

Protein IDFamilyRBSSequence
B570J13895_10015851F054867GGAGLDSSVALLQTASGLERLMAGSVPGVIKDSTVAQVSAFLYYEAAVIAKLTTNAEFKNLFKTTIFNQIEKDFGQYVDAQARVKPKSLHHVYEWNKTGNPTARLFNLYLIDSEGLSFRVGRDFKL
B570J13895_10015854F001106AGGAGMSFETLKVAELRKIAEDFAVDTDGIKSKADIVAALAEEGVTWSVYQKTIKDIEDATDEFNEDAEEILPRFSLDAQPEDTVLVRMTRENFRYDIIGFTFTKEHPFIAMTEENAQEIFDKEEGFRLATPKEVQEYYN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.