NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold B570J14230_10002745

Scaffold B570J14230_10002745


Overview

Basic Information
Taxon OID3300001282 Open in IMG/M
Scaffold IDB570J14230_10002745 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7085
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (18.18%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, WI
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F102592Metagenome / Metatranscriptome101N

Sequences

Protein IDFamilyRBSSequence
B570J14230_100027453F102592N/AMNVVDDDDDITVPXPVYMKWPKNFTCQDSPTPVLKIQYEGLSNTTSPHRNPAFITLTNKKAFTIPSCNYAIIHFPVLVRTSLPAVSILYNNDFLYKHGLTCVINQIPTNDTLLHIKVFNHKLIPLTFEKESLQFICHTVLAKYP*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.