Scaffold JGI20129J14369_1000640

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI20129J14369_1000640

Scaffold JGI20129J14369_1000640

Overview

Basic Information
Taxon OID	3300001309 Open in IMG/M
Scaffold ID	JGI20129J14369_1000640 Open in IMG/M
Source Dataset Name	Hypoxic/sulfidic aquatic microbial communities from Monarch Geyser, Yellowstone National Park, USA - MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5262
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (63.64%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Vulcanisaeta	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Unclassified → Unclassified → Hypoxic/Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico

Source Dataset Sampling Location
Location Name	Monarch Geyser, Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.376	Long. (^o)	-110.69	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076261	Metagenome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20129J14369_10006409	F076261	GGA	MMPGLISSTPFWNGLALINRYRVKPPMNIPVGAIGAVAFQTGGGSGSAPPVVSSALSYFSPFFAAIMLFLGVAFWASLLFLIYYGIEAFAHPTPFGRSSRLASMYDHVKSIIWSIIAIYLVVAVIAFAVNQASAAAGAGTTVSAGQLFYYVFVEPIVNGFKLFFSYA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.