Basic Information | |
---|---|
Taxon OID | 3300001340 Open in IMG/M |
Scaffold ID | JGI20133J14441_1052071 Open in IMG/M |
Source Dataset Name | Ferric oxide microbial mat and aquatic microbial communities from Rainbow Spring, Yellowstone National Park, USA - RS3B |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 862 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hypersaline Mat → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F033508 | Metagenome / Metatranscriptome | 177 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI20133J14441_10520712 | F033508 | N/A | RLPNTVANCVSITAPGYKVQGKGFLWGLSDLFGAEHLPNAAEDEDINVTLNAAATRIDAYYAEIKPQDVSSHSVNGGSDAKVKPFIELLDTLVTTTGTGQNVLNENMPTGLGLLDNNGRVKATTQFTLLTAFADYVSSGTNFTEYSRLHIYDEDEELFTPLNHEGLFIDYTVAEGDLFMNWTVRQYFKPDQPYIFKPNHQISLKADVPAVTGTGSTLRVALIGVRERIG* |
⦗Top⦘ |