NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI20154J14316_10104991

Scaffold JGI20154J14316_10104991


Overview

Basic Information
Taxon OID3300001348 Open in IMG/M
Scaffold IDJGI20154J14316_10104991 Open in IMG/M
Source Dataset NamePelagic Microbial community sample from North Sea - COGITO 998_met_04
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)886
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameHelgoland, sampling site Kabeltonne
CoordinatesLat. (o)54.184167Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003051Metagenome / Metatranscriptome510Y
F015812Metagenome / Metatranscriptome252Y
F106085Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
JGI20154J14316_101049912F015812AGGAGMSEMNRTLYKKLEDICAREYVVNKLSEHKFRTFVDFLYDDIRTWDKPTDVSDVDIIHRIEEHLSYMVSRRLADAHIGTNHD*
JGI20154J14316_101049913F106085AGGMTNNPLERLRKKLSFLLDNLKNKFRMLIKSKQNNKIIINKDIKNNIPKHLKGLNNKQLKDLESLFRMRI*
JGI20154J14316_101049914F003051GAGGMKVKHLKTKVSIDMSVSEYDTLFKYINKIDSMLNTLHETNDLWLSDVHNLSSLRYELVELLDAEWNPDTYRYVK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.