Scaffold JGI12269J14319_10004595

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12269J14319_10004595

Scaffold JGI12269J14319_10004595

Overview

Basic Information
Taxon OID	3300001356 Open in IMG/M
Scaffold ID	JGI12269J14319_10004595 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12519
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (90.91%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location Name	Germany: Weissenstadt
Coordinates	Lat. (^o)	50.13	Long. (^o)	11.88	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014188	Metagenome / Metatranscriptome	265	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12269J14319_100045955	F014188	GGA	VNVNTLTPSQQSTELHEICDQLKRMGYAQSKRIRIYGQEFEAVSNPFPHGDGIAIKAFSKRETQARTLCLPLPVVQMVTRQKHKKIA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.