Scaffold YBBDRAFT_1156042

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold YBBDRAFT_1156042

Scaffold YBBDRAFT_1156042

Overview

Basic Information
Taxon OID	3300001372 Open in IMG/M
Scaffold ID	YBBDRAFT_1156042 Open in IMG/M
Source Dataset Name	YB-Back-sed
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of South Carolina
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1333
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine → Marine And Estuarine Microbial Communities From Columbia River Coastal Margin

Source Dataset Sampling Location
Location Name	Youngs Bay mouth
Coordinates	Lat. (^o)	46.15968	Long. (^o)	-123.80651	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F068264	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
YBBDRAFT_11560423	F068264	AGG	MKLNEITAEDVLAGKLWIIEPGQDGETNPTVKESVGFAGEDTGLISAVVRIADGSEHLGLVVKSFPQGGDDVDIYIKTNFGWLNIHANGFMRALGKYSHEIFPFDYFLSSPWKGGKQPEPDK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.