Basic Information | |
---|---|
Taxon OID | 3300001446 Open in IMG/M |
Scaffold ID | JGI20130J15133_1002026 Open in IMG/M |
Source Dataset Name | Sulfidic aquatic microbial communities from Washburn Spring, Yellowstone National Park, USA - WS |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 15664 |
Total Scaffold Genes | 20 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 15 (75.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Euryarchaeota | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Non-Marine Saline And Alkaline → Alkaline → Unclassified → Sulfidic Aquatic → Saline, Thermophilic Phototrophic And Chemotrophic Mat Microbial Communities From Various Locations In Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Washburn Spring, Yellowstone National Park, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.376 | Long. (o) | -110.69 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024925 | Metagenome / Metatranscriptome | 204 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI20130J15133_100202620 | F024925 | N/A | RLAKNFILKNISATQPDAEVRFVDDEHFTIIFKRIDPLVMNSQRVLIESMFRELGYEITTTAFQNLLSFKLKLLEKPVLEPLPRKKLMQILIEGMSCNSVEEAFAIEKEQLDELFPEDYPWTIREVGERITDMYRELGIEVEIEYFEGGFTLKYKSCPYYKLVKTGQKTWLCSLRKKTIEYIISRVSHGKKGKIKIIKSLLQNEHPCEYAIFLTGFLEKEEKIEAQE* |
⦗Top⦘ |