NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24006J15134_10002957

Scaffold JGI24006J15134_10002957


Overview

Basic Information
Taxon OID3300001450 Open in IMG/M
Scaffold IDJGI24006J15134_10002957 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-53
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9218
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)49.5666Long. (o)-138.6666Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000413Metagenome / Metatranscriptome1169Y
F000983Metagenome / Metatranscriptome814Y

Sequences

Protein IDFamilyRBSSequence
JGI24006J15134_1000295713F000413N/AVKKFYSIKLKQFKENIPPALAETMLLDESKLVKYLWKHKALEFRYPKHKIRLDLYADEKYLMMGKLKYPTMFGNRKRMGFMELYLVHKINQRMIKAKGST*
JGI24006J15134_100029577F000983N/AMKSFFILDCEKQQKIADSLYGYYKGITANNPPTKFWTHLTREQIKDYLSIPNLELTKWFDSLGLRARDMSFTITNESIHTDIHRDEPPVIAKINFPVLNTKDTYNVWYDDYANEIDRVECLKPIVLRSDILHSVEMGNTAEYPRLQFSFCFYNEPLHLLK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.