NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24006J15134_10011657

Scaffold JGI24006J15134_10011657


Overview

Basic Information
Taxon OID3300001450 Open in IMG/M
Scaffold IDJGI24006J15134_10011657 Open in IMG/M
Source Dataset NameMarine viral communities from the Pacific Ocean - LP-53
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4290
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (7.69%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Viral Communities From The Subarctic Pacific Ocean And The Gulf Of Mexico

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)49.5666Long. (o)-138.6666Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F037414Metagenome / Metatranscriptome168Y
F084361Metagenome112N

Sequences

Protein IDFamilyRBSSequence
JGI24006J15134_100116572F084361N/AMNSNYKVIEIYVEENIISKIDIIKSEWGVDDVVKGVFMDIDIKGGEGEWNDMLYYGIKKIDEKEDIGVIGYGEESVLFVIGDKNKWYNKVDEFNLDSKEKEVNFSNGLYNEENYNEWVEFVEGLVDSINW*
JGI24006J15134_100116573F037414N/AMNMIKDKDGREIRVGSIVKMKSEDIEDGIVVGFDNGRVDVVELGDGFTIDADSIEVVSELNG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.