NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI20162J15292_1000006

Scaffold JGI20162J15292_1000006


Overview

Basic Information
Taxon OID3300001468 Open in IMG/M
Scaffold IDJGI20162J15292_1000006 Open in IMG/M
Source Dataset NameCubitermes ugandensis midgut segment microbial communities from Kakamega Forest, Kenya - Cu122M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7844
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (27.27%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location NameKakamega Forest, Kenya
CoordinatesLat. (o)0.2917Long. (o)34.856Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060415Metagenome133Y

Sequences

Protein IDFamilyRBSSequence
JGI20162J15292_100000610F060415N/AMSLLVIDFTYLEGRDGELLVKELAAVDSHRNRVSSYIFKKPYGWEEVPMFNARINEAIDHGCNWNDGDVLYSELETVLHREASSAVAIYCFGPLKTQFISGLLERTVIDIMQLGCPELADISLANISCTFACHNKSKHVCALRTAYSLAQWLNFYTLSVQYAKCPPQPAFH*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.