NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Mariner_1112731

Scaffold Mariner_1112731


Overview

Basic Information
Taxon OID3300001522 Open in IMG/M
Scaffold IDMariner_1112731 Open in IMG/M
Source Dataset NameHydrothermal vent plume microbial communities from Mariner/Tui Malila, Pacific Ocean, of black smokers
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1398
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Tui Malila, Pacific Ocean, Of Black Smokers

Source Dataset Sampling Location
Location NameMariner, ELSC, Pacific Ocean
CoordinatesLat. (o)-20.064428Long. (o)-176.171974Alt. (m)Depth (m)1900
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016735Metagenome245Y
F074128Metagenome120N

Sequences

Protein IDFamilyRBSSequence
Mariner_11127312F016735GAGMTDQMFFLVWFLSFGLYLVIYTWWIPIRTRKNIEAWLMDSESDETLLASLEVITTKIREQVLVDFEEFMLPQARDSFKNFWNGAMGNAAQELSKTEEGSQLSLMHGVASELKDQPWYVQAAASKILPLISKAAESQGDATSTPLKGLGIAK*
Mariner_11127314F074128N/AQVLLLSHPHPDYSSLDKKGKRLTWRTNCHVVRVTIMDLFSKADDTTAEFVSDWYEHTWTIECREDGNIWVEG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.