Scaffold chfec4_10124865

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold chfec4_10124865

Scaffold chfec4_10124865

Overview

Basic Information
Taxon OID	3300001525 Open in IMG/M
Scaffold ID	chfec4_10124865 Open in IMG/M
Source Dataset Name	Chimp virome sample 4
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	558
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Primate Fecal → Primate Fecal Viral Communities From Gombe National Park, Tanzania

Source Dataset Sampling Location
Location Name	Gombe National Park, Tanzania
Coordinates	Lat. (^o)	-4.4	Long. (^o)	29.38	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F092227	Metagenome	107	N

Sequences

Protein ID	Family	RBS	Sequence
chfec4_101248652	F092227	AGGAG	MNEQKHKRWLRIGCLILAGVFALSLLSSVIMMLLF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.