Basic Information | |
---|---|
Taxon OID | 3300001528 Open in IMG/M |
Scaffold ID | chfe1id_10194357 Open in IMG/M |
Source Dataset Name | Virome of Chimps sample 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 538 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → unclassified bacterial viruses → virus sp. ct6GG30 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Primate Fecal → Primate Fecal Viral Communities From Gombe National Park, Tanzania |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Gombe National Park, Tanzania | |||||||
Coordinates | Lat. (o) | -4.4 | Long. (o) | 29.38 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F067720 | Metagenome | 125 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
chfe1id_101943571 | F067720 | AGGAG | MASTTYEHFVDTNKMYAVQEQFRHVTKMVCDFVKINKIDLFAALGNMARNAGQLPQPFWLGAACGGGSRSAAPCAART* |
⦗Top⦘ |