Scaffold JGI20169J15301_1018980

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI20169J15301_1018980

Scaffold JGI20169J15301_1018980

Overview

Basic Information
Taxon OID	3300001541 Open in IMG/M
Scaffold ID	JGI20169J15301_1018980 Open in IMG/M
Source Dataset Name	Nasutitermes corniger P1 segment gut microbial community from laboratory colony in Florida, USA - Nc150 P1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	539
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location Name	laboratory colony in Florida, USA
Coordinates	Lat. (^o)	26.0625	Long. (^o)	-80.2332	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001336	Metagenome	720	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20169J15301_10189801	F001336	N/A	MQQSIVKFYCFVVQTLLKHVSGIIMPIIGARQTAVAASGFHMNV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.