Basic Information | |
---|---|
Taxon OID | 3300001544 Open in IMG/M |
Scaffold ID | JGI20163J15578_10126152 Open in IMG/M |
Source Dataset Name | Cubitermes ugandensis P1 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1597 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Kakamega Forest, Kenya | |||||||
Coordinates | Lat. (o) | 0.2917 | Long. (o) | 34.856 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001302 | Metagenome | 727 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI20163J15578_101261521 | F001302 | N/A | VGDGEKLLTHLNSALKVLLGLDIFPRVPKKRLNLVDQCNRR* |
⦗Top⦘ |