Basic Information | |
---|---|
Taxon OID | 3300001546 Open in IMG/M |
Scaffold ID | JGI12659J15293_10012634 Open in IMG/M |
Source Dataset Name | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2329 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Algoma, Ontario, Canada | |||||||
Coordinates | Lat. (o) | 46.42 | Long. (o) | -83.37 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F010557 | Metagenome / Metatranscriptome | 302 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
JGI12659J15293_100126342 | F010557 | AGGAG | VNKDRTNSNTALENYLKFGRQFGDGEKFYLLGFEAALHARNRCKEFDQIASEMTSDLEELQEQYPRVAVEEPFTRGFQQGREYYQRLCDESTVS* |
⦗Top⦘ |