NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Draft_10000905

Scaffold Draft_10000905


Overview

Basic Information
Taxon OID3300001567 Open in IMG/M
Scaffold IDDraft_10000905 Open in IMG/M
Source Dataset NameHydrocarbon resource environments microbial communities from Canada and USA - Toluene degrading community from Alberta, Canada
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMcGill University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)46093
Total Scaffold Genes41 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)24 (58.54%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location NameNorthern Alberta, Canada
CoordinatesLat. (o)54.0Long. (o)-114.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010797Metagenome / Metatranscriptome299Y
F027639Metagenome194Y

Sequences

Protein IDFamilyRBSSequence
Draft_1000090514F010797N/AMDFAPEVTLKMLDSRSRRWTVIASGLLCGALAIVVLFTNRRAFFSPLAVVVMGAVGLAAVLLQLRLQNRDQAPSSSSPAWLNVLGILFALAAFFADLFHATPQVTEALALGAVASFGVSGVIILRSFRKRATSK*
Draft_100009052F027639GGAGMTTVFPIDRELGGHSLTWQCPPALDFPTEAIECFREGVERLQTGDPGAALTALSRSTEIAPAFGEAHVFLGLANALTHNIYPAIDHLELATRLQPDSFAAHYTLAQLNFKLRIPQKGYAASEQALRCVSTLEQRKMLTQLLKEERARERNGIARPWFNKSYSKPGLFLAGSGLAAVIGALLLHVRW*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.