 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300001580 Open in IMG/M |
| Scaffold ID | Draft_10000039 Open in IMG/M |
| Source Dataset Name | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | McGill University |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 134898 |
| Total Scaffold Genes | 122 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 87 (71.31%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → Viruses → Duplodnaviria → Heunggongvirae | (Source: IMG-VR) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Suncor Tailings Pond 6, Northern Alberta, Canada | |||||||
| Coordinates | Lat. (o) | 57.05 | Long. (o) | -111.55 | Alt. (m) | Depth (m) | 6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F024289 | Metagenome / Metatranscriptome | 206 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Draft_1000003957 | F024289 | GGA | MALTPLTEQQKTRIVNNVVKACRNIDSLNKTGYNFLNQCSGFIAHYDLYGFQEAYSDGSLKRELVSYAGQNQWKNFRPGERDYDYYMSKADVYNRILAEIL* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |