Scaffold Draft_10017448

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Draft_10017448

Scaffold Draft_10017448

Overview

Basic Information
Taxon OID	3300001580 Open in IMG/M
Scaffold ID	Draft_10017448 Open in IMG/M
Source Dataset Name	Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	McGill University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5645
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments → Hydrocarbon Resource Environments Microbial Communities From Canada And Usa

Source Dataset Sampling Location
Location Name	Suncor Tailings Pond 6, Northern Alberta, Canada
Coordinates	Lat. (^o)	57.05	Long. (^o)	-111.55	Alt. (m)		Depth (m)	6
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005327	Metagenome / Metatranscriptome	404	Y

Sequences

Protein ID	Family	RBS	Sequence
Draft_100174483	F005327	GGAG	MIFGVNATKSAVVVAQTRGASANFVITAIKHISFQVRSGDELAELLQNLSRLFDSNGKAAGSVIALLKCSSGRFGSCLEAIKGEAMVELAASQRGLRIVKIAPQSLKKMLGCAKDQKWRDRAGELFNPDGKRPDWYKGAAGAVAAAFKVAGE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.