Scaffold JGI12053J15887_10017161

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI12053J15887_10017161

Scaffold JGI12053J15887_10017161

Overview

Basic Information
Taxon OID	3300001661 Open in IMG/M
Scaffold ID	JGI12053J15887_10017161 Open in IMG/M
Source Dataset Name	Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4024
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location Name	El Dorado National Forest, Georgetown, California, USA
Coordinates	Lat. (^o)	38.88	Long. (^o)	-120.64	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080400	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12053J15887_100171612	F080400	GAG	MRRGLLITLLLLSLGARFYAVENGELTMTIVRAEEKKRDRVVAWVNDTPIYQQDPYFDVAVRAGDKVLEGEYEPSSQWETLPVFWKPGVKVQGRVRGHSLFLKRPNGVEIRFVILKRNTISADQKR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.