NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold TahiMoana_1048247

Scaffold TahiMoana_1048247


Overview

Basic Information
Taxon OID3300001679 Open in IMG/M
Scaffold IDTahiMoana_1048247 Open in IMG/M
Source Dataset NameBlack smokers hydrothermal plume microbial communities from Tahi Moana, Lau Basin, Pacific Ocean
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1279
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Tahi Moana, Lau Basin, Pacific Ocean

Source Dataset Sampling Location
Location NameTahi Moana, Lau Basin, Pacific Ocean
CoordinatesLat. (o)-20.682131Long. (o)-176.183363Alt. (m)Depth (m)2230
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014552Metagenome262Y
F016735Metagenome245Y

Sequences

Protein IDFamilyRBSSequence
TahiMoana_10482471F016735N/ARTQKKIESWLLSEESNETLLASLGVITNQIREQALVDFEEFMIPQGRKAAIDFWNGAMGNAAQKLGETEEGSQLSLLHSMTEELKDQPWYVQAAASKLIPVISKAAKNQDKPKVTKLVHGKFGFD*
TahiMoana_10482473F014552N/AMGSAYAPLLIFEYNGTSFILELTGVMMSLKQDKKYSLGTPSLMRGLDKGQECEVKFLTDPKPVETEHGSKFDIQVQLLSHPHESYSSLPKEGRRLTWRTNCHVVRVTIMDLFAHEAEFPGANEFAKDWTERTWTISCKEDGNIWIDA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.