NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Abe_10058693

Scaffold Abe_10058693


Overview

Basic Information
Taxon OID3300001681 Open in IMG/M
Scaffold IDAbe_10058693 Open in IMG/M
Source Dataset NameBlack smokers hydrothermal plume microbial communities from Abe, Lau Basin, Pacific Ocean - IDBA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2138
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Black Smokers Hydrothermal Plume → Black Smokers Hydrothermal Plume Microbial Communities From Abe, Lau Basin, Pacific Ocean

Source Dataset Sampling Location
Location NameAbe, ELSC, Pacific Ocean
CoordinatesLat. (o)-20.111307Long. (o)-176.989014Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067242Metagenome126Y

Sequences

Protein IDFamilyRBSSequence
Abe_100586935F067242N/AMSMKLSRGCKQRIKMLTQAERKSLCKSAKSLAEVECITMKRADAVIRWCQKGGY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.