Scaffold GBIDBA_10061658

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GBIDBA_10061658

Scaffold GBIDBA_10061658

Overview

Basic Information
Taxon OID	3300001683 Open in IMG/M
Scaffold ID	GBIDBA_10061658 Open in IMG/M
Source Dataset Name	Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1337
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From Guaymas Basin, Pacific Ocean

Source Dataset Sampling Location
Location Name	Guyams Basin, Gulf of California, Pacific Ocean
Coordinates	Lat. (^o)	27.015833	Long. (^o)	-111.425	Alt. (m)		Depth (m)	1993
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041250	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
GBIDBA_100616584	F041250	N/A	MPMTVNGTIGAVSEHSLVKAAVPFVVAAILGFCSFLFNSVMSLEQQVKLLNEGTVHNLEEKVDKMSEKIDTMNIILTDLRVSLGGRDRRDQHQ*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.