NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold C688J18823_10284122

Scaffold C688J18823_10284122


Overview

Basic Information
Taxon OID3300001686 Open in IMG/M
Scaffold IDC688J18823_10284122 Open in IMG/M
Source Dataset NameGrasslands soil microbial communities from Hopland, California, USA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1090
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Grasslands → Soil → Soil Microbial Communities From Mediterranean Grasslands, California

Source Dataset Sampling Location
Location NameUSA: Hopland, California
CoordinatesLat. (o)38.99297339Long. (o)-123.0674491Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015501Metagenome / Metatranscriptome254Y

Sequences

Protein IDFamilyRBSSequence
C688J18823_102841221F015501GGAMNPVYRIDAERKLVSLYWADFPTLPCLKQVVDEAIADPEFARGMNFLWDRNPGVPNTADVEYIRGAVYYAQILAEQIGPHAWAVIAHNAADFGKARMLETLSDQSKVTIRAFKSRGDAEEWLRNPVRYEPIVIHFPARNPSLFHPGLA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.