NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold WOR8_10000017

Scaffold WOR8_10000017


Overview

Basic Information
Taxon OID3300001687 Open in IMG/M
Scaffold IDWOR8_10000017 Open in IMG/M
Source Dataset NameDeep Marine Sediments WOR-3-8_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)457137
Total Scaffold Genes408 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)336 (82.35%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.640199Long. (o)-77.109447Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048675Metagenome148Y
F050381Metagenome / Metatranscriptome145Y

Sequences

Protein IDFamilyRBSSequence
WOR8_10000017222F050381GGAGMKKLPIIVAIILLPSIALATFSIQFDNTTDQKLFYSLYWIDHNYDWPHPFNMAGGELGAQQKIDLKVRPKNGKYYVIWSDRGEWQNKVMLNVNAGVTSVKVTPVKSNMQ*
WOR8_10000017388F048675AGGAMKNKEANADGNEMLFFEHHAAAQSLKNAWTRLASTYGCIMVVLYRKKLMIKPHWYAKWLINLLGLDLSHEIPITHIKGVMEVGKRFSYGKLEVRFNTVTGEDRSILLYMKKDSEFIDKVKNAITR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.