NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold JGI24657J20077_1004982

Scaffold JGI24657J20077_1004982


Overview

Basic Information
Taxon OID3300001738 Open in IMG/M
Scaffold IDJGI24657J20077_1004982 Open in IMG/M
Source Dataset NameMarine viral communities from the Deep Pacific Ocean - MSP-118
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2291
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)11.9811Long. (o)-108.0335Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F051970Metagenome143Y

Sequences

Protein IDFamilyRBSSequence
JGI24657J20077_10049823F051970GGAGGMTEKNLTGNSNGKQELLDDNVVVLQQDIAEVMKEDPMLNLKIVNKALNRENKQLKEQIRVMGEAGVNKAKEGKNATNG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.