Scaffold JGI24658J20074_1010369

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24658J20074_1010369

Scaffold JGI24658J20074_1010369

Overview

Basic Information
Taxon OID	3300001739 Open in IMG/M
Scaffold ID	JGI24658J20074_1010369 Open in IMG/M
Source Dataset Name	Marine viral communities from the Deep Pacific Ocean - MSP-121
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	880
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Source Dataset Sampling Location
Location Name	Pacific Ocean
Coordinates	Lat. (^o)	10.0693	Long. (^o)	-99.2557	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038409	Metagenome	166	N

Sequences

Protein ID	Family	RBS	Sequence
JGI24658J20074_10103693	F038409	N/A	MATVGSGPLKRVDTGATVGADGTVTRIVAIHATATVSGMIEFKGEQQITNHTAQGTAIRLAIQANGVIDTYFGEIGVPIYGKVTVSAPDAGPVTAILG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.