 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300001744 Open in IMG/M |
| Scaffold ID | JGI24669J20092_10144855 Open in IMG/M |
| Source Dataset Name | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 2 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 544 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Nematocera → Culicomorpha → Culicoidea → Culicidae → Culicinae → Culicini → Culex → Culex → Culex pipiens complex → Culex quinquefasciatus | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Italy: Sant'Andrea, Tuscany | |||||||
| Coordinates | Lat. (o) | 42.8072 | Long. (o) | 10.1411 | Alt. (m) | Depth (m) | 6 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F049277 | Metagenome | 147 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI24669J20092_101448551 | F049277 | N/A | ADLLQHAKLAESAGTGTTDDNLDDTEIRQLRDEVRAGREEVQRLNAKMTRMTLSAVQQRSPTPTRRPQHVSFRRDGGWEERRDGGPNRGAASFARGNRRGQYRPYNNNRITQSSGYGPGMMPRECSRCGRYHTDNRPCPAAGLSCFNCGRVGHLRARCFMGRRASTNP* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |